- ERP29 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-88395
- Unconjugated
- 0.1 ml (also 25ul)
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- ERP29
- endoplasmic reticulum protein 29
- WB, IHC, IHC-p
- Human (Hu)
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Core ESC Like Genes, Membrane Trafficking and Chaperones, Stem Cell Markers
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
- C12orf8, ERp28, ERp31, HEL-S-107, PDI-DB, PDIA9
- This antibody was developed against Recombinant Protein corresponding to amino acids: SYPVFYLFRD GDFENPVPYT GAVKVGAIQR WLKGQGVYLG MPGCLPVYDA LAGEFIRASG VEARQALLKQ GQDNLSSV
Sequence
SYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSV
Specifications/Features
Available conjugates: Unconjugated